GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
BR
- Product Code: 105932
Molecular Weight: | 3850.31 g./mol | Molecular Formula: | |
---|---|---|---|
EC Number: | MDL Number: | ||
Melting Point: | Boiling Point: | ||
Density: | Storage Condition: | -20°C |
Product Description:
This peptide sequence is primarily used in research and development within the field of biotechnology and pharmaceuticals. It is often studied for its potential role in protein engineering and drug design, particularly in the development of therapeutic peptides. Researchers explore its interactions with other biological molecules to understand its function and potential applications in treating diseases. Additionally, it may be utilized in the development of biosensors or as a model compound in studies related to protein folding, stability, and molecular recognition. Its specific sequence suggests potential relevance in targeting certain biological pathways or receptors, making it a candidate for further investigation in personalized medicine and targeted therapies.
Sizes / Availability / Pricing:
Size (g) | Availability | Price | Quantity |
---|---|---|---|
0.005 | 10-20 days | Ft760,221.06 |
+
-
|
GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
This peptide sequence is primarily used in research and development within the field of biotechnology and pharmaceuticals. It is often studied for its potential role in protein engineering and drug design, particularly in the development of therapeutic peptides. Researchers explore its interactions with other biological molecules to understand its function and potential applications in treating diseases. Additionally, it may be utilized in the development of biosensors or as a model compound in studies related to protein folding, stability, and molecular recognition. Its specific sequence suggests potential relevance in targeting certain biological pathways or receptors, making it a candidate for further investigation in personalized medicine and targeted therapies.
Mechanism | - |
Appearance | - |
Longevity | - |
Strength | - |
Storage | - |
Shelf Life | - |
Allergen(s) | - |
Dosage (Range) | - |
Recommended Dosage | - |
Dosage (Per Day) | - |
Recommended Dosage (Per Day) | - |
Mix Method | - |
Heat Resistance | - |
Stable in pH range | - |
Solubility | - |
Product Types | - |
INCI | - |
Cart
No products
Subtotal:
Ft0.00
Ft0.00
Total :