FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
BR
- Product Code: 105920
Molecular Weight: | 3692.15 g./mol | Molecular Formula: | |
---|---|---|---|
EC Number: | MDL Number: | ||
Melting Point: | Boiling Point: | ||
Density: | Storage Condition: | -20°C |
Product Description:
This peptide sequence is primarily used in research and development within the fields of biochemistry and molecular biology. It is often employed in studies related to protein-protein interactions, as it can serve as a model or target sequence to investigate binding mechanisms. Additionally, it may be utilized in the development of antibodies or as a synthetic antigen to study immune responses. Its specific structure allows it to be a valuable tool in understanding conformational changes in proteins and their functional implications. Researchers also use it in peptide synthesis experiments to optimize production techniques and analyze purification processes.
Sizes / Availability / Pricing:
Size (g) | Availability | Price | Quantity |
---|---|---|---|
0.005 | 10-20 days | $3,543.95 |
+
-
|
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
This peptide sequence is primarily used in research and development within the fields of biochemistry and molecular biology. It is often employed in studies related to protein-protein interactions, as it can serve as a model or target sequence to investigate binding mechanisms. Additionally, it may be utilized in the development of antibodies or as a synthetic antigen to study immune responses. Its specific structure allows it to be a valuable tool in understanding conformational changes in proteins and their functional implications. Researchers also use it in peptide synthesis experiments to optimize production techniques and analyze purification processes.
Mechanism | - |
Appearance | - |
Longevity | - |
Strength | - |
Storage | - |
Shelf Life | - |
Allergen(s) | - |
Dosage (Range) | - |
Recommended Dosage | - |
Dosage (Per Day) | - |
Recommended Dosage (Per Day) | - |
Mix Method | - |
Heat Resistance | - |
Stable in pH range | - |
Solubility | - |
Product Types | - |
INCI | - |
Cart
No products
Subtotal:
$0.00
$0.00
Total :