FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

BR

Product Code: 105920

Molecular Weight:	Molecular Formula:
EC Number:	MDL Number:
Melting Point:	Boiling Point:
Density:	Storage Condition:	-20°C

Product Description: This peptide sequence is primarily used in research and development within the fields of biochemistry and molecular biology. It is often employed in studies related to protein-protein interactions, as it can serve as a model or target sequence to investigate binding mechanisms. Additionally, it may be utilized in the development of antibodies or as a synthetic antigen to study immune responses. Its specific structure allows it to be a valuable tool in understanding conformational changes in proteins and their functional implications. Researchers also use it in peptide synthesis experiments to optimize production techniques and analyze purification processes.

Sizes / Availability / Pricing:

Size (g)	Availability	Price	Quantity
0.005	10-20 days	฿70,560.00	+ -

FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

This peptide sequence is primarily used in research and development within the fields of biochemistry and molecular biology. It is often employed in studies related to protein-protein interactions, as it can serve as a model or target sequence to investigate binding mechanisms. Additionally, it may be utilized in the development of antibodies or as a synthetic antigen to study immune responses. Its specific structure allows it to be a valuable tool in understanding conformational changes in proteins and their functional implications. Researchers also use it in peptide synthesis experiments to optimize production techniques and analyze purification processes.

Mechanism	-
Appearance	-
Longevity	-
Strength	-
Storage	-
Shelf Life	-
Allergen(s)	-
Dosage (Range)	-
Recommended Dosage	-
Dosage (Per Day)	-
Recommended Dosage (Per Day)	-
Mix Method	-
Heat Resistance	-
Stable in pH range	-
Solubility	-
Product Types	-
INCI	-

Cart

No products

Subtotal: ฿0.00

฿0.00 Total :

Cart
Checkout