GLP-1(7-37),HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
>98%
- Product Code: 105925
CAS:
106612-94-6
| Molecular Weight: | 3355.67 g./mol | Molecular Formula: | C₁₅₁H₂₂₈N₄₀O₄₇ |
|---|---|---|---|
| EC Number: | MDL Number: | ||
| Melting Point: | Boiling Point: | ||
| Density: | Storage Condition: | -20°C |
Product Description:
GLP-1(7-37) is widely used in the treatment of type 2 diabetes due to its ability to enhance insulin secretion in a glucose-dependent manner. This peptide helps regulate blood sugar levels by stimulating insulin release from pancreatic beta cells while inhibiting glucagon secretion, which reduces hepatic glucose production. Additionally, it slows gastric emptying, contributing to better postprandial glucose control. Beyond diabetes management, GLP-1(7-37) has shown potential in promoting weight loss by increasing satiety and reducing appetite, making it beneficial for obesity-related conditions. Its therapeutic applications are also being explored in cardiovascular health, as it may improve heart function and reduce the risk of cardiovascular events in diabetic patients.
Sizes / Availability / Pricing:
| Size (g) | Availability | Price | Quantity |
|---|---|---|---|
| 0.005 | 10-20 days | ฿53,028.00 |
+
-
|
GLP-1(7-37),HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
GLP-1(7-37) is widely used in the treatment of type 2 diabetes due to its ability to enhance insulin secretion in a glucose-dependent manner. This peptide helps regulate blood sugar levels by stimulating insulin release from pancreatic beta cells while inhibiting glucagon secretion, which reduces hepatic glucose production. Additionally, it slows gastric emptying, contributing to better postprandial glucose control. Beyond diabetes management, GLP-1(7-37) has shown potential in promoting weight loss by increasing satiety and reducing appetite, making it beneficial for obesity-related conditions. Its therapeutic applications are also being explored in cardiovascular health, as it may improve heart function and reduce the risk of cardiovascular events in diabetic patients.
| Mechanism | - |
| Appearance | - |
| Longevity | - |
| Strength | - |
| Storage | - |
| Shelf Life | - |
| Allergen(s) | - |
| Dosage (Range) | - |
| Recommended Dosage | - |
| Dosage (Per Day) | - |
| Recommended Dosage (Per Day) | - |
| Mix Method | - |
| Heat Resistance | - |
| Stable in pH range | - |
| Solubility | - |
| Product Types | - |
| INCI | - |
Cart
No products
Subtotal:
฿0.00
฿0.00
Total :