GLP-1(7-37),HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG

>98%

  • Product Code: 105925
  CAS:    106612-94-6
Molecular Weight: 3355.67 g./mol Molecular Formula: C₁₅₁H₂₂₈N₄₀O₄₇
EC Number: MDL Number:
Melting Point: Boiling Point:
Density: Storage Condition: -20°C
Product Description: GLP-1(7-37) is widely used in the treatment of type 2 diabetes due to its ability to enhance insulin secretion in a glucose-dependent manner. This peptide helps regulate blood sugar levels by stimulating insulin release from pancreatic beta cells while inhibiting glucagon secretion, which reduces hepatic glucose production. Additionally, it slows gastric emptying, contributing to better postprandial glucose control. Beyond diabetes management, GLP-1(7-37) has shown potential in promoting weight loss by increasing satiety and reducing appetite, making it beneficial for obesity-related conditions. Its therapeutic applications are also being explored in cardiovascular health, as it may improve heart function and reduce the risk of cardiovascular events in diabetic patients.
Sizes / Availability / Pricing:
Size (g) Availability Price Quantity
0.005 10-20 days $2,085.38
+
-
GLP-1(7-37),HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
GLP-1(7-37) is widely used in the treatment of type 2 diabetes due to its ability to enhance insulin secretion in a glucose-dependent manner. This peptide helps regulate blood sugar levels by stimulating insulin release from pancreatic beta cells while inhibiting glucagon secretion, which reduces hepatic glucose production. Additionally, it slows gastric emptying, contributing to better postprandial glucose control. Beyond diabetes management, GLP-1(7-37) has shown potential in promoting weight loss by increasing satiety and reducing appetite, making it beneficial for obesity-related conditions. Its therapeutic applications are also being explored in cardiovascular health, as it may improve heart function and reduce the risk of cardiovascular events in diabetic patients.
Mechanism -
Appearance -
Longevity -
Strength -
Storage -
Shelf Life -
Allergen(s) -
Dosage (Range) -
Dosage (Per Day) -
Mix Method -
Heat Resistance -
Stable in pH range -
Solubility -
Product Types -
INCI -

Cart

No products

Subtotal: $0.00
$0.00 Total :

The availability date depends on real-time stock, and any changes after payment will be notified within 30 minutes
You can choose the delivery date on the next page