GLP-2(1-33)(human),GLP-2 (human),Glucagon-like peptide 2 (human),HADGSFSDEMNTILDNLAARDFINWLIQTKITD
BR
- Product Code: 105926
CAS:
223460-79-5
Molecular Weight: | 2816.28 g./mol | Molecular Formula: | C₁₂₆H₂₀₇N₃₇O₃₄S |
---|---|---|---|
EC Number: | MDL Number: | ||
Melting Point: | Boiling Point: | ||
Density: | Storage Condition: | -20°C |
Product Description:
GLP-2 (human) is primarily used in medical and therapeutic applications due to its role in promoting intestinal growth and function. It is particularly effective in treating conditions like short bowel syndrome (SBS), where it enhances nutrient absorption by increasing the surface area of the intestinal lining. This peptide also supports gut health by reducing inflammation and improving barrier function, making it valuable in managing inflammatory bowel diseases (IBD) such as Crohn’s disease. Additionally, GLP-2 has shown potential in treating conditions like osteoporosis, as it may improve bone density by enhancing calcium absorption in the intestines. Its ability to stimulate cell proliferation and repair in the gastrointestinal tract makes it a promising candidate for further research in regenerative medicine and gastrointestinal disorders.
Sizes / Availability / Pricing:
Size (g) | Availability | Price | Quantity |
---|---|---|---|
0.001 | 10-20 days | ฿29,115.00 |
+
-
|
GLP-2(1-33)(human),GLP-2 (human),Glucagon-like peptide 2 (human),HADGSFSDEMNTILDNLAARDFINWLIQTKITD
GLP-2 (human) is primarily used in medical and therapeutic applications due to its role in promoting intestinal growth and function. It is particularly effective in treating conditions like short bowel syndrome (SBS), where it enhances nutrient absorption by increasing the surface area of the intestinal lining. This peptide also supports gut health by reducing inflammation and improving barrier function, making it valuable in managing inflammatory bowel diseases (IBD) such as Crohn’s disease. Additionally, GLP-2 has shown potential in treating conditions like osteoporosis, as it may improve bone density by enhancing calcium absorption in the intestines. Its ability to stimulate cell proliferation and repair in the gastrointestinal tract makes it a promising candidate for further research in regenerative medicine and gastrointestinal disorders.
Mechanism | - |
Appearance | - |
Longevity | - |
Strength | - |
Storage | - |
Shelf Life | - |
Allergen(s) | - |
Dosage (Range) | - |
Recommended Dosage | - |
Dosage (Per Day) | - |
Recommended Dosage (Per Day) | - |
Mix Method | - |
Heat Resistance | - |
Stable in pH range | - |
Solubility | - |
Product Types | - |
INCI | - |
Cart
No products
Subtotal:
฿0.00
฿0.00
Total :