Amyloid β Peptide (42-1)(human) (AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD)
98%
- Product Code: 107637
CAS:
317366-82-8
| Molecular Weight: | 4514.04 g./mol | Molecular Formula: | C₂₀₃H₃₁₁N₅₅O₆₀S |
|---|---|---|---|
| EC Number: | MDL Number: | ||
| Melting Point: | Boiling Point: | ||
| Density: | Storage Condition: | -20°C, airtight, dry |
Product Description:
Amyloid β Peptide (42-1)(human) is widely used in neuroscience and Alzheimer's disease research. It plays a critical role in studying the mechanisms of amyloid plaque formation, which is a hallmark of Alzheimer's. Researchers utilize this peptide to investigate its aggregation properties, neurotoxicity, and interactions with other proteins or molecules in the brain. It is also employed in developing and testing potential therapeutic agents aimed at inhibiting amyloid aggregation or clearing amyloid plaques. Additionally, it serves as a key component in creating in vitro and in vivo models to better understand the pathophysiology of Alzheimer's disease and to evaluate drug efficacy.
Sizes / Availability / Pricing:
| Size (g) | Availability | Price | Quantity |
|---|---|---|---|
| 0.001 | 10-20 days | ฿5,553.00 |
+
-
|
Amyloid β Peptide (42-1)(human) (AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD)
Amyloid β Peptide (42-1)(human) is widely used in neuroscience and Alzheimer's disease research. It plays a critical role in studying the mechanisms of amyloid plaque formation, which is a hallmark of Alzheimer's. Researchers utilize this peptide to investigate its aggregation properties, neurotoxicity, and interactions with other proteins or molecules in the brain. It is also employed in developing and testing potential therapeutic agents aimed at inhibiting amyloid aggregation or clearing amyloid plaques. Additionally, it serves as a key component in creating in vitro and in vivo models to better understand the pathophysiology of Alzheimer's disease and to evaluate drug efficacy.
| Mechanism | - |
| Appearance | - |
| Longevity | - |
| Strength | - |
| Storage | - |
| Shelf Life | - |
| Allergen(s) | - |
| Dosage (Range) | - |
| Recommended Dosage | - |
| Dosage (Per Day) | - |
| Recommended Dosage (Per Day) | - |
| Mix Method | - |
| Heat Resistance | - |
| Stable in pH range | - |
| Solubility | - |
| Product Types | - |
| INCI | - |
Cart
No products
Subtotal:
฿0.00
฿0.00
Total :