Amyloid β Peptide (42-1)(human) (AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD)

98%

  • Product Code: 107637
  CAS:    317366-82-8
Molecular Weight: 4514.04 g./mol Molecular Formula: C₂₀₃H₃₁₁N₅₅O₆₀S
EC Number: MDL Number:
Melting Point: Boiling Point:
Density: Storage Condition: -20°C, airtight, dry
Product Description: Amyloid β Peptide (42-1)(human) is widely used in neuroscience and Alzheimer's disease research. It plays a critical role in studying the mechanisms of amyloid plaque formation, which is a hallmark of Alzheimer's. Researchers utilize this peptide to investigate its aggregation properties, neurotoxicity, and interactions with other proteins or molecules in the brain. It is also employed in developing and testing potential therapeutic agents aimed at inhibiting amyloid aggregation or clearing amyloid plaques. Additionally, it serves as a key component in creating in vitro and in vivo models to better understand the pathophysiology of Alzheimer's disease and to evaluate drug efficacy.
Sizes / Availability / Pricing:
Size (g) Availability Price Quantity
0.001 10-20 days $278.90
+
-
Amyloid β Peptide (42-1)(human) (AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD)
Amyloid β Peptide (42-1)(human) is widely used in neuroscience and Alzheimer's disease research. It plays a critical role in studying the mechanisms of amyloid plaque formation, which is a hallmark of Alzheimer's. Researchers utilize this peptide to investigate its aggregation properties, neurotoxicity, and interactions with other proteins or molecules in the brain. It is also employed in developing and testing potential therapeutic agents aimed at inhibiting amyloid aggregation or clearing amyloid plaques. Additionally, it serves as a key component in creating in vitro and in vivo models to better understand the pathophysiology of Alzheimer's disease and to evaluate drug efficacy.
Mechanism -
Appearance -
Longevity -
Strength -
Storage -
Shelf Life -
Allergen(s) -
Dosage (Range) -
Dosage (Per Day) -
Mix Method -
Heat Resistance -
Stable in pH range -
Solubility -
Product Types -
INCI -

Cart

No products

Subtotal: $0.00
$0.00 Total :

The availability date depends on real-time stock, and any changes after payment will be notified within 30 minutes
You can choose the delivery date on the next page