Amyloid β-peptide (1-40) (rat) (DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV)
98%
- Product Code: 110055
CAS:
144409-98-3
| Molecular Weight: | 4233.76 g./mol | Molecular Formula: | C₁₉₀H₂₉₁N₅₁O₅₇S |
|---|---|---|---|
| EC Number: | MDL Number: | ||
| Melting Point: | Boiling Point: | ||
| Density: | Storage Condition: | -20°C, airtight, dry |
Product Description:
Amyloid β-peptide (1-40) (rat) is widely used in neuroscience and Alzheimer's disease research. It serves as a model to study the aggregation and toxicity of amyloid peptides, which are key factors in the pathogenesis of Alzheimer's. Researchers utilize this peptide to investigate the mechanisms of amyloid plaque formation, neuronal cell death, and synaptic dysfunction. It is also employed in drug discovery to screen and test potential therapeutic compounds aimed at inhibiting amyloid aggregation or reducing its neurotoxic effects. Additionally, it is used in biochemical assays to study interactions with other proteins, lipids, and cellular components, providing insights into the molecular basis of neurodegeneration.
Sizes / Availability / Pricing:
| Size (g) | Availability | Price | Quantity |
|---|---|---|---|
| 0.001 | 10-20 days | ฿17,271.00 |
+
-
|
Amyloid β-peptide (1-40) (rat) (DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV)
Amyloid β-peptide (1-40) (rat) is widely used in neuroscience and Alzheimer's disease research. It serves as a model to study the aggregation and toxicity of amyloid peptides, which are key factors in the pathogenesis of Alzheimer's. Researchers utilize this peptide to investigate the mechanisms of amyloid plaque formation, neuronal cell death, and synaptic dysfunction. It is also employed in drug discovery to screen and test potential therapeutic compounds aimed at inhibiting amyloid aggregation or reducing its neurotoxic effects. Additionally, it is used in biochemical assays to study interactions with other proteins, lipids, and cellular components, providing insights into the molecular basis of neurodegeneration.
| Mechanism | - |
| Appearance | - |
| Longevity | - |
| Strength | - |
| Storage | - |
| Shelf Life | - |
| Allergen(s) | - |
| Dosage (Range) | - |
| Recommended Dosage | - |
| Dosage (Per Day) | - |
| Recommended Dosage (Per Day) | - |
| Mix Method | - |
| Heat Resistance | - |
| Stable in pH range | - |
| Solubility | - |
| Product Types | - |
| INCI | - |
Cart
No products
Subtotal:
฿0.00
฿0.00
Total :