VSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
BR
- Product Code: 65755
Molecular Weight: | 3241.7 g./mol | Molecular Formula: | |
---|---|---|---|
EC Number: | MDL Number: | ||
Melting Point: | Boiling Point: | ||
Density: | Storage Condition: | -20°C |
Product Description:
This peptide sequence is a synthetic or naturally derived peptide that is primarily used in research and development within the fields of biochemistry and molecular biology. Its applications include:
1. **Protein-Protein Interaction Studies**: It is utilized to investigate how proteins interact with each other, which is crucial for understanding cellular processes and signaling pathways.
2. **Drug Development**: The peptide may serve as a template or target for designing new therapeutic agents, particularly in the development of drugs that modulate protein interactions.
3. **Biomarker Research**: It can be employed in the identification and validation of biomarkers for various diseases, aiding in early diagnosis and treatment strategies.
4. **Enzyme Activity Studies**: Researchers use this peptide to study enzyme kinetics and mechanisms, helping to elucidate the role of specific enzymes in biological systems.
5. **Immunological Research**: The peptide might be used in immunological studies to understand immune responses and develop vaccines or immunotherapies.
Overall, this peptide is a valuable tool in advancing scientific knowledge and developing new medical treatments.
Sizes / Availability / Pricing:
Size | Availability | Price | Quantity |
---|---|---|---|
0.005 G | 10-20 days | ฿70,560.00 |
+
-
|
VSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
This peptide sequence is a synthetic or naturally derived peptide that is primarily used in research and development within the fields of biochemistry and molecular biology. Its applications include:
1. **Protein-Protein Interaction Studies**: It is utilized to investigate how proteins interact with each other, which is crucial for understanding cellular processes and signaling pathways.
2. **Drug Development**: The peptide may serve as a template or target for designing new therapeutic agents, particularly in the development of drugs that modulate protein interactions.
3. **Biomarker Research**: It can be employed in the identification and validation of biomarkers for various diseases, aiding in early diagnosis and treatment strategies.
4. **Enzyme Activity Studies**: Researchers use this peptide to study enzyme kinetics and mechanisms, helping to elucidate the role of specific enzymes in biological systems.
5. **Immunological Research**: The peptide might be used in immunological studies to understand immune responses and develop vaccines or immunotherapies.
Overall, this peptide is a valuable tool in advancing scientific knowledge and developing new medical treatments.
Mechanism | - |
Appearance | - |
Longevity | - |
Strength | - |
Storage | - |
Shelf Life | - |
Allergen(s) | - |
Dosage (Range) | - |
Recommended Dosage | - |
Dosage (Per Day) | - |
Recommended Dosage (Per Day) | - |
Mix Method | - |
Heat Resistance | - |
Stable in pH range | - |
Solubility | - |
Product Types | - |
INCI | - |
Purchase History for
Loading purchase history...
Cart
No products
Subtotal:
฿0.00
฿0.00
Total :