VSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

BR

  • Product Code: 65755
Molecular Weight: 3241.7 g./mol Molecular Formula:
EC Number: MDL Number:
Melting Point: Boiling Point:
Density: Storage Condition: -20°C
Product Description: This peptide sequence is a synthetic or naturally derived peptide that is primarily used in research and development within the fields of biochemistry and molecular biology. Its applications include: 1. **Protein-Protein Interaction Studies**: It is utilized to investigate how proteins interact with each other, which is crucial for understanding cellular processes and signaling pathways. 2. **Drug Development**: The peptide may serve as a template or target for designing new therapeutic agents, particularly in the development of drugs that modulate protein interactions. 3. **Biomarker Research**: It can be employed in the identification and validation of biomarkers for various diseases, aiding in early diagnosis and treatment strategies. 4. **Enzyme Activity Studies**: Researchers use this peptide to study enzyme kinetics and mechanisms, helping to elucidate the role of specific enzymes in biological systems. 5. **Immunological Research**: The peptide might be used in immunological studies to understand immune responses and develop vaccines or immunotherapies. Overall, this peptide is a valuable tool in advancing scientific knowledge and developing new medical treatments.
Sizes / Availability / Pricing:
Size Availability Price Quantity
0.005 G 10-20 days ฿70,560.00
+
-
VSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
This peptide sequence is a synthetic or naturally derived peptide that is primarily used in research and development within the fields of biochemistry and molecular biology. Its applications include: 1. **Protein-Protein Interaction Studies**: It is utilized to investigate how proteins interact with each other, which is crucial for understanding cellular processes and signaling pathways. 2. **Drug Development**: The peptide may serve as a template or target for designing new therapeutic agents, particularly in the development of drugs that modulate protein interactions. 3. **Biomarker Research**: It can be employed in the identification and validation of biomarkers for various diseases, aiding in early diagnosis and treatment strategies. 4. **Enzyme Activity Studies**: Researchers use this peptide to study enzyme kinetics and mechanisms, helping to elucidate the role of specific enzymes in biological systems. 5. **Immunological Research**: The peptide might be used in immunological studies to understand immune responses and develop vaccines or immunotherapies. Overall, this peptide is a valuable tool in advancing scientific knowledge and developing new medical treatments.
Mechanism -
Appearance -
Longevity -
Strength -
Storage -
Shelf Life -
Allergen(s) -
Dosage (Range) -
Dosage (Per Day) -
Mix Method -
Heat Resistance -
Stable in pH range -
Solubility -
Product Types -
INCI -

Purchase History for

Loading purchase history...

Cart

No products

Subtotal: ฿0.00
฿0.00 Total :

The availability date depends on real-time stock, and any changes after payment will be notified within 30 minutes
You can choose the delivery date on the next page