VSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

BR

Reagent Code: #65755

blur_circular Chemical Specifications

scatter_plot Molecular Information
Weight 3241.7 g/mol
inventory_2 Storage & Handling
Storage -20°C

description Product Description

This peptide sequence is a synthetic or naturally derived peptide that is primarily used in research and development within the fields of biochemistry and molecular biology. Its applications include:

  1. Protein-Protein Interaction Studies: It is utilized to investigate how proteins interact with each other, which is crucial for understanding cellular processes and signaling pathways.
  2. Drug Development: The peptide may serve as a template or target for designing new therapeutic agents, particularly in the development of drugs that modulate protein interactions.
  3. Biomarker Research: It can be employed in the identification and validation of biomarkers for various diseases, aiding in early diagnosis and treatment strategies.
  4. Enzyme Activity Studies: Researchers use this peptide to study enzyme kinetics and mechanisms, helping to elucidate the role of specific enzymes in biological systems.
  5. Immunological Research: The peptide might be used in immunological studies to understand immune responses and develop vaccines or immunotherapies.

Overall, this peptide is a valuable tool in advancing scientific knowledge and developing new medical treatments.

Available Sizes & Pricing

Size Availability Unit Price Quantity
5mg
10-20 days ฿70,560.00
VSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
No image available

This peptide sequence is a synthetic or naturally derived peptide that is primarily used in research and development within the fields of biochemistry and molecular biology. Its applications include:

  1. Protein-Protein Interaction Studies: It is utilized to investigate how proteins interact with each other, which is crucial for understanding cellular processes and signaling pathways.
  2. Drug Development: The peptide may serve as a template or target for desi

This peptide sequence is a synthetic or naturally derived peptide that is primarily used in research and development within the fields of biochemistry and molecular biology. Its applications include:

  1. Protein-Protein Interaction Studies: It is utilized to investigate how proteins interact with each other, which is crucial for understanding cellular processes and signaling pathways.
  2. Drug Development: The peptide may serve as a template or target for designing new therapeutic agents, particularly in the development of drugs that modulate protein interactions.
  3. Biomarker Research: It can be employed in the identification and validation of biomarkers for various diseases, aiding in early diagnosis and treatment strategies.
  4. Enzyme Activity Studies: Researchers use this peptide to study enzyme kinetics and mechanisms, helping to elucidate the role of specific enzymes in biological systems.
  5. Immunological Research: The peptide might be used in immunological studies to understand immune responses and develop vaccines or immunotherapies.

Overall, this peptide is a valuable tool in advancing scientific knowledge and developing new medical treatments.

Mechanism -
Appearance -
Longevity -
Strength -
Storage -
Shelf Life -
Allergen(s) -
Dosage (Range) -
Dosage (Per Day) -
Mix Method -
Heat Resistance -
Stable in pH range -
Solubility -
Product Types -
INCI -

Purchase History for

Loading purchase history...