GLP-1 moiety from Dulaglitude,HGEGTFTSDVSSYLEEQAAKEFIAWLVKGGG
>96%
blur_circular Chemical Specifications
description Product Description
The GLP-1 moiety derived from Dulaglutide is a synthetic peptide analog of the endogenous incretin hormone GLP-1, primarily utilized in pharmaceutical research and development for type 2 diabetes mellitus treatments. It acts as an incretin mimetic, enhancing glucose-dependent insulin secretion from pancreatic beta cells to improve blood sugar control. It also suppresses glucagon secretion, reducing hepatic glucose production, and slows gastric emptying, which promotes a feeling of fullness and supports weight management. These mechanisms contribute to better glycemic control and have shown potential in reducing cardiovascular risks in preclinical and clinical studies of GLP-1 analogs.
format_list_bulleted Product Specification
| Test Parameter | Specification |
|---|---|
| Appearance | White to Off-White Solid |
| Purity (%) | 96-100 |
| NMR | Conforms to Structure |