GLP-1 moiety from Dulaglitude,HGEGTFTSDVSSYLEEQAAKEFIAWLVKGGG

>96%

Reagent Code: #105919

blur_circular Chemical Specifications

scatter_plot Molecular Information
Weight 3314.62 g/mol
Formula C₁₄₉H₂₂₁N₃₇O₄₉
inventory_2 Storage & Handling
Storage -20°C

description Product Description

The GLP-1 moiety derived from Dulaglutide is a synthetic peptide analog of the endogenous incretin hormone GLP-1, primarily utilized in pharmaceutical research and development for type 2 diabetes mellitus treatments. It acts as an incretin mimetic, enhancing glucose-dependent insulin secretion from pancreatic beta cells to improve blood sugar control. It also suppresses glucagon secretion, reducing hepatic glucose production, and slows gastric emptying, which promotes a feeling of fullness and supports weight management. These mechanisms contribute to better glycemic control and have shown potential in reducing cardiovascular risks in preclinical and clinical studies of GLP-1 analogs.

format_list_bulleted Product Specification

Test Parameter Specification
Appearance White to Off-White Solid
Purity (%) 96-100
NMR Conforms to Structure

Available Sizes & Pricing

Size Availability Unit Price Quantity
1mg
10-20 days ฿25,200.00
GLP-1 moiety from Dulaglitude,HGEGTFTSDVSSYLEEQAAKEFIAWLVKGGG
No image available

The GLP-1 moiety derived from Dulaglutide is a synthetic peptide analog of the endogenous incretin hormone GLP-1, primarily utilized in pharmaceutical research and development for type 2 diabetes mellitus treatments. It acts as an incretin mimetic, enhancing glucose-dependent insulin secretion from pancreatic beta cells to improve blood sugar control. It also suppresses glucagon secretion, reducing hepatic glucose production, and slows gastric emptying, which promotes a feeling of fullness and supports w

The GLP-1 moiety derived from Dulaglutide is a synthetic peptide analog of the endogenous incretin hormone GLP-1, primarily utilized in pharmaceutical research and development for type 2 diabetes mellitus treatments. It acts as an incretin mimetic, enhancing glucose-dependent insulin secretion from pancreatic beta cells to improve blood sugar control. It also suppresses glucagon secretion, reducing hepatic glucose production, and slows gastric emptying, which promotes a feeling of fullness and supports weight management. These mechanisms contribute to better glycemic control and have shown potential in reducing cardiovascular risks in preclinical and clinical studies of GLP-1 analogs.

Mechanism -
Appearance -
Longevity -
Strength -
Storage -
Shelf Life -
Allergen(s) -
Dosage (Range) -
Dosage (Per Day) -
Mix Method -
Heat Resistance -
Stable in pH range -
Solubility -
Product Types -
INCI -

Purchase History for

Loading purchase history...