GLP-1 moiety from Dulaglitude,HGEGTFTSDVSSYLEEQAAKEFIAWLVKGGG
>96%
Reagent
Code: #105919
blur_circular Chemical Specifications
scatter_plot
Molecular Information
Weight
3314.62 g/mol
Formula
C₁₄₉H₂₂₁N₃₇O₄₉
inventory_2
Storage & Handling
Storage
-20°C
description Product Description
The GLP-1 moiety derived from Dulaglutide is a synthetic peptide analog of the endogenous incretin hormone GLP-1, primarily utilized in pharmaceutical research and development for type 2 diabetes mellitus treatments. It acts as an incretin mimetic, enhancing glucose-dependent insulin secretion from pancreatic beta cells to improve blood sugar control. It also suppresses glucagon secretion, reducing hepatic glucose production, and slows gastric emptying, which promotes a feeling of fullness and supports weight management. These mechanisms contribute to better glycemic control and have shown potential in reducing cardiovascular risks in preclinical and clinical studies of GLP-1 analogs.
shopping_cart Available Sizes & Pricing
Cart
No products
Subtotal:
0.00
Total
0.00
THB