Amyloid β-peptide (1-40) (rat) (DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV)

98%

Reagent Code: #110055
fingerprint
CAS Number 144409-98-3

science Other reagents with same CAS 144409-98-3

blur_circular Chemical Specifications

scatter_plot Molecular Information
Weight 4233.76 g/mol
Formula C₁₉₀H₂₉₁N₅₁O₅₇S
inventory_2 Storage & Handling
Storage -20°C, airtight, dry

description Product Description

Amyloid β-peptide (1-40) (rat) is widely used in neuroscience and Alzheimer's disease research. It serves as a model to study the aggregation and toxicity of amyloid peptides, which are key factors in the pathogenesis of Alzheimer's. Researchers utilize this peptide to investigate the mechanisms of amyloid plaque formation, neuronal cell death, and synaptic dysfunction. It is also employed in drug discovery to screen and test potential therapeutic compounds aimed at inhibiting amyloid aggregation or reducing its neurotoxic effects. Additionally, it is used in biochemical assays to study interactions with other proteins, lipids, and cellular components, providing insights into the molecular basis of neurodegeneration.

Available Sizes & Pricing

Size Availability Unit Price Quantity
1mg
10-20 days ฿17,271.00
Amyloid β-peptide (1-40) (rat) (DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV)
No image available

Amyloid β-peptide (1-40) (rat) is widely used in neuroscience and Alzheimer's disease research. It serves as a model to study the aggregation and toxicity of amyloid peptides, which are key factors in the pathogenesis of Alzheimer's. Researchers utilize this peptide to investigate the mechanisms of amyloid plaque formation, neuronal cell death, and synaptic dysfunction. It is also employed in drug discovery to screen and test potential therapeutic compounds aimed at inhibiting amyloid aggregation or redu

Amyloid β-peptide (1-40) (rat) is widely used in neuroscience and Alzheimer's disease research. It serves as a model to study the aggregation and toxicity of amyloid peptides, which are key factors in the pathogenesis of Alzheimer's. Researchers utilize this peptide to investigate the mechanisms of amyloid plaque formation, neuronal cell death, and synaptic dysfunction. It is also employed in drug discovery to screen and test potential therapeutic compounds aimed at inhibiting amyloid aggregation or reducing its neurotoxic effects. Additionally, it is used in biochemical assays to study interactions with other proteins, lipids, and cellular components, providing insights into the molecular basis of neurodegeneration.

Mechanism -
Appearance -
Longevity -
Strength -
Storage -
Shelf Life -
Allergen(s) -
Dosage (Range) -
Dosage (Per Day) -
Mix Method -
Heat Resistance -
Stable in pH range -
Solubility -
Product Types -
INCI -

Purchase History for

Loading purchase history...