FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

BR

  • Product Code: 105920
Molecular Weight: 3692.15 g./mol Molecular Formula:
EC Number: MDL Number:
Melting Point: Boiling Point:
Density: Storage Condition: -20°C
Product Description: This peptide sequence is primarily used in research and development within the fields of biochemistry and molecular biology. It is often employed in studies related to protein-protein interactions, as it can serve as a model or target sequence to investigate binding mechanisms. Additionally, it may be utilized in the development of antibodies or as a synthetic antigen to study immune responses. Its specific structure allows it to be a valuable tool in understanding conformational changes in proteins and their functional implications. Researchers also use it in peptide synthesis experiments to optimize production techniques and analyze purification processes.
Sizes / Availability / Pricing:
Size Availability Price Quantity
5mg 10-20 days ฿70,560.00
+
-
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
This peptide sequence is primarily used in research and development within the fields of biochemistry and molecular biology. It is often employed in studies related to protein-protein interactions, as it can serve as a model or target sequence to investigate binding mechanisms. Additionally, it may be utilized in the development of antibodies or as a synthetic antigen to study immune responses. Its specific structure allows it to be a valuable tool in understanding conformational changes in proteins and their functional implications. Researchers also use it in peptide synthesis experiments to optimize production techniques and analyze purification processes.
Mechanism -
Appearance -
Longevity -
Strength -
Storage -
Shelf Life -
Allergen(s) -
Dosage (Range) -
Dosage (Per Day) -
Mix Method -
Heat Resistance -
Stable in pH range -
Solubility -
Product Types -
INCI -

Purchase History for

Loading purchase history...

Cart

No products

Subtotal: ฿0.00
฿0.00 Total :

The availability date depends on real-time stock, and any changes after payment will be notified within 30 minutes
You can choose the delivery date on the next page