GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
BR
blur_circular Chemical Specifications
description Product Description
This peptide sequence is a synthetic analog resembling GLP-1 receptor agonists and is primarily used in research and development within biotechnology and pharmaceuticals. It is studied for its potential to mimic glucagon-like peptide-1 (GLP-1) effects, including glucose regulation, insulin secretion stimulation, and glucagon suppression. Key applications focus on developing therapeutics for type 2 diabetes and obesity. Researchers explore its interactions with GLP-1 receptors and biological molecules to understand functions in metabolic pathways, with emerging interests in neuroprotection, cardiovascular benefits, and immune modulation. Additionally, it serves in biosensors, protein folding and stability studies, molecular recognition, and as a model for personalized medicine and targeted therapies.