Amyloid β Peptide (42-1)(human) (AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD)

98%

Reagent Code: #107637
fingerprint
CAS Number 317366-82-8

science Other reagents with same CAS 317366-82-8

blur_circular Chemical Specifications

scatter_plot Molecular Information
Weight 4514.04 g/mol
Formula C₂₀₃H₃₁₁N₅₅O₆₀S
inventory_2 Storage & Handling
Storage -20°C, airtight, dry

description Product Description

Amyloid β Peptide (42-1)(human) is widely used in neuroscience and Alzheimer's disease research. It plays a critical role in studying the mechanisms of amyloid plaque formation, which is a hallmark of Alzheimer's. Researchers utilize this peptide to investigate its aggregation properties, neurotoxicity, and interactions with other proteins or molecules in the brain. It is also employed in developing and testing potential therapeutic agents aimed at inhibiting amyloid aggregation or clearing amyloid plaques. Additionally, it serves as a key component in creating in vitro and in vivo models to better understand the pathophysiology of Alzheimer's disease and to evaluate drug efficacy.

format_list_bulleted Product Specification

Test Parameter Specification
Appearance White to Off-White Solid
Purity (%) 95-100
Infrared Spectrum Conforms to Structure
NMR Conforms to Structure

shopping_cart Available Sizes & Pricing

Size Availability Unit Price Quantity
inventory 1mg
10-20 days ฿5,553.00
Amyloid β Peptide (42-1)(human) (AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD)
No image available
Amyloid β Peptide (42-1)(human) is widely used in neuroscience and Alzheimer's disease research. It plays a critical role in studying the mechanisms of amyloid plaque formation, which is a hallmark of Alzheimer's. Researchers utilize this peptide to investigate its aggregation properties, neurotoxicity, and interactions with other proteins or molecules in the brain. It is also employed in developing and testing potential therapeutic agents aimed at inhibiting amyloid aggregation or clearing amyloid plaques. Additionally, it serves as a key component in creating in vitro and in vivo models to better understand the pathophysiology of Alzheimer's disease and to evaluate drug efficacy.
Mechanism -
Appearance -
Longevity -
Strength -
Storage -
Shelf Life -
Allergen(s) -
Dosage (Range) -
Dosage (Per Day) -
Mix Method -
Heat Resistance -
Stable in pH range -
Solubility -
Product Types -
INCI -

Purchase History for

Loading purchase history...